PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G109879_P02
Common NameZm.26595
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family B3
Protein Properties Length: 586aa    MW: 65102.6 Da    PI: 10.7672
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G109879_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B339.21.3e-12381112699
                        T.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                 B3  26 h.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                        +     g+  +e+ t  + ++ g++W+v++   + + +  l++GW eF  a+g+  g fvv++++g  ++ l+vkvf++
  GRMZM2G109879_P02  38 CfdageGEGAPEP-TALVVSPFGKVWRVEV--VRDGHGASLGRGWAEFLAAHGVGIGWFVVLRYEG--GGALTVKVFDT 111
                        2466652233355.788899**********..77777788***********************987..6678*****97 PP

2B339.88.2e-13145228996
                        HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                 B3   9 dvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                        ++l+++ ++lp +f++++ +++  +s+  ++ ++  + W+v+l  ++ ++++++t+GW++F + +g+k g+++++k++g++ f  ++k+
  GRMZM2G109879_P02 145 SNLSEK-MMLPARFVKDYvSEECLNSRIAIIFSPIAKFWRVEL--KNDQSGIFFTGGWSQFLDFHGIKNGEVLLLKYEGNMVF--KFKA 228
                        455554.9**********855556777888889**********..999999****************************9999..5554 PP

3B355.21.3e-17301384186
                        EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                        ++k+ ++ ++l++  l l+ kf++++g   ++++tl+  + s rsW+v+ +   k  ry+++ GWk+F+++n+Lk+gD ++F  ++
  GRMZM2G109879_P02 301 WIKKRINTYALEQF-LALSVKFCNSIGFRMACTITLKTATNSTRSWQVRGT-AYKWHRYIIGVGWKSFCQDNRLKAGDLCTFNIIE 384
                        68999999999998.***********99999*99999999999*******3.344456************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010192.5E-618112IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.4E-1318113IPR015300DNA-binding pseudobarrel domain
CDDcd100173.42E-1018110No hitNo description
SuperFamilySSF1019366.67E-1418114IPR015300DNA-binding pseudobarrel domain
PfamPF023626.4E-1030111IPR003340B3 DNA binding domain
PROSITE profilePS508639.96859112IPR003340B3 DNA binding domain
PROSITE profilePS5086311.448136232IPR003340B3 DNA binding domain
CDDcd100174.22E-11137229No hitNo description
SMARTSM010193.2E-13139232IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.5E-15139234IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.28E-16140238IPR015300DNA-binding pseudobarrel domain
PfamPF023622.6E-10144226IPR003340B3 DNA binding domain
SuperFamilySSF1019366.67E-16300394IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.702300396IPR003340B3 DNA binding domain
SMARTSM010191.1E-5302396IPR003340B3 DNA binding domain
PfamPF023624.6E-13302384IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.1E-18302395IPR015300DNA-binding pseudobarrel domain
CDDcd100173.38E-10314380No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 586 aa     Download sequence    Send to blast
MPLPSDSGSG ARAMSKQFKV LLPTSFHKLR ISDELAGCFD AGEGEGAPEP TALVVSPFGK  60
VWRVEVVRDG HGASLGRGWA EFLAAHGVGI GWFVVLRYEG GGALTVKVFD TSLCIKEFGA  120
PAAVMPSKSC KSIFCKPQFI RIFHSNLSEK MMLPARFVKD YVSEECLNSR IAIIFSPIAK  180
FWRVELKNDQ SGIFFTGGWS QFLDFHGIKN GEVLLLKYEG NMVFKFKAFG LSGCQKDFKN  240
QNAGIQLNTK KQQETPPIRK RKSNDEKSSS EENKRLKTPV TSPSPSDPSL EKPYQIGTSS  300
WIKKRINTYA LEQFLALSVK FCNSIGFRMA CTITLKTATN STRSWQVRGT AYKWHRYIIG  360
VGWKSFCQDN RLKAGDLCTF NIIETTLWHV TITRSALAAD TFNKQKKPPC SSSRDKKGSS  420
SREGAKRPKP SMAHFSKVQV PPSYARRCAY DVGPPPWIRK QMNASTIRNR LVRMVILAFD  480
SRKLVIGVKI IQNTYEPVWH RPSAIRLSCG DAARSCSRPR STAIILGGLV VSRRRRVVTL  540
LGPVGKNSAR RTELRLVMSA PSMSSKPSCG MSSSHAVAKL WLLQPA
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.265950.0ear| meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G109879
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G109879_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9433830.0EU943383.1 Zea mays clone 1616277 mRNA sequence.
GenBankKJ7278460.0KJ727846.1 Zea mays clone pUT5890 ABI3VP1 transcription factor (ABI28) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008669670.10.0PREDICTED: putative B3 domain-containing protein Os04g0347400
SwissprotQ7XS751e-113Y4469_ORYSJ; Putative B3 domain-containing protein Os04g0346900
TrEMBLA0A096RRW00.0A0A096RRW0_MAIZE; Uncharacterized protein
STRINGGRMZM2G109879_P020.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Representative plantOGRP10106410
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.19e-11B3 family protein